2010 jeep jk torque specs Sep 21, 2015 · 1754 posts · Joined 2010 then torque to 105 in/lbs. For the JL model, the torque spec is 70 lb/ft. The automatic transmissions available were the 42RLE (4-speed) and the 545RFE (5-speed). lbs. (longer yoke). Feb 23, 2020 · SOLD 2018 Gobi Recon unlimited, Mopar 2" lift coils combined with RK rear coils wedges, AEV geo brackets, AEV rear track bar, TF rear track bar bracket, Falcon 3. I started Jeep Wrangler TJ Forum to serve as a resource for TJ owners around the world. Aug 25, 2015 · The recommended torque setting for a Jeep Wrangler JK differential drain plug is 25 ft. 6-liter V6 engine, producing 285 horsepower and 260 lb. I highly recommend you pick up a Haynes for $25 at the parts store. I didn't like that, plus, didn't have a torque wrench that would go that high. Mar 20, 2018 · engine cylinders horsepower torque fuel tank capacity epa mileage estimate 3. 2010 Wrangler Parts; 2009 Wrangler Parts; 2008 Wrangler Parts; 2018 - 2020 Jeep Wrangler Unlimited Rubicon (4 door): JLUR 1999 - 2004 Jeep Grand Cherokee WJ Front Dana Super 30 (186 mm / 7. Some manuals indicate 95 ft-lbs or even 122 ft-lbs for certain years, so it's best to check your specific year's manual. 83 spec. Noticed oil on my carport last week (5/13/2014) and sure enough there was a slow oil leak somewhere. 8 with new bearings and races. 814 posts · Joined 2010 A forum community dedicated to Jeep Wrangler JK May 8, 2025 · Jeep Wrangler JK Showcase. these are the torque specs for those screws, nuts and bolts all over your tub. The 20. 5" Springs/Rancho 9000XL's/JKS Adjustable Rear Sway Bar Links/Rancho Control Arm Drop Brackets/Teraflex Rear Track Bar Bracket/Goodyear Duratrac's 33X12. 2010 Wrangler Parts; 2009 Wrangler Parts; 2008 Wrangler Parts; Jeep Wrangler JK Showcase. 5" lift, Falcon shocks, 35" Dick Cepek M/T tires My build: Copper Rubi build 2010 BMW Z4 35i - toy 2016 Volvo XC90 - dogmobile Nov 9, 2021 · Just talked to the tech guys at Adams. (2) Install the nuts attaching the bumper to the rear frame crossmember. Jan 17, 2005 · I replaced the transmission filter with a kit from NAPA - ATP 17077. is also the torque in lbs. 1997-2006 TJ. 8 CRD 2007, 2008, 2009, 2010, 2011 detailed specs, including 0-60 mph times, horsepower, and handling data. Oct 28, 2017 · The torque spec for tie rod ends on a Jeep Wrangler TJ seems to vary. 5") Hypoid offset: 1. pdf), Text File (. ! Don't step on the brakes once the caliper is pulled off the rotor. 00! Bolt Sizes & Torque Specs|Northridge4x4 866-601-5340 Bolt sizes and torque specifications for tons of parts on your Jeep JL or Jeep JK. Oct 10, 2011 · 2004 Grand Cherokee Limited 4. I will use the 15 inch lbs as the spec though. Contents. 6L V6 thermostat housing replacement; Jeep JK cabin air filter replacement; Jeep JK Differential Fluid Change; Jeep JK 3. (4) If equipped, Connect the fog lamp harness connector. I looked up the max torque specs for the M14-1. Rear Bumper - INSTALLATION (1) Position the bumper on the vehicle. Some sources, including older Jeep FSMs, suggest 35 ft-lbs for the ball stud. 8L Engine Torque Specs; 2010 Wrangler Parts; 2009 Wrangler Parts; March 2, 2009 Cindy Jeep JK Tech, Jeep JK Write-Ups, Operation & Maintenance 24 As a part of routine maintenance or anytime that you work on your Jeep JK Wrangler, it is important that you tighten any bolt and/or nut that gets removed back to the appropriate torque settings as is outlined by the Factory Service Manual. Mar 20, 2018 · Jeep Wrangler JK Showcase. Dec 20, 2011 · Wheel Bearing Torque Specs Jump to Latest 104K views 2 replies 3 participants last post by Amelie Dec 21, 2011 Jeep Wrangler Torque Specs. Manual Transmission (NSG370) Torque Specs Torque Specs. 50 -19 Offset/Level 8 Trackers 15X8/SC Flashpaq/aFe Exhaust & CAI/Or-Fab Front and Rear Bumpers/Trucklite Headlights/SEOUL LED Fogs/Synergy Grab Bars/Mopar Sill Guards/Husky Mats/AntennaX 13"/Daystar Hood To make things easier for you, we have compiled a detailed chart with the recommended lug nut torque specifications for the Jeep Wrangler JK. for a 3. 1997-2006. Aug 12, 2022 · Jeep Jk Torque Specs . They don't give out torque specs. I used the rubber gasket from the kit and torqued the pan bolts to 165 in-lbs. Be careful when tightening, as some users have reported the bolts snapping even before reaching 11 ft-lbs. Slide the supplied yoke over the transfer case output shaft. 8") Hypoid offset: 1. ). 2011-2019 Jeep Grand Cherokee WK2; 2005-2010 Jeep Grand Cherokee WK; 1999-2004 Jeep Grand Cherokee WJ; 1993-1998 Jeep Grand Cherokee ZJ; 2014-2019 Jeep Cherokee KL; 1984-2001 Jeep Feb 6, 2017 · To round out this topic: I just replaced my rear ball joint today. Mar 20, 2017 · 7) When balancer is fully seated onto the shaft remove the "specialized tool" we just made and use the torque wrench to torque the harmonic balancer bolt to the correct specs (40 ft/lbs). Jeep TJ Torque Specs. The Haynes manual states "refer to this chapter for torque specs" but it doesn't contain the specs for the pan bolts in any of the chapters. Here you'll find a treasure trove of knowledge amongst some of the most knowledgable minds in the TJ community. TeraFlex’s Steering Stabilzer Relocation . 2011-2019 Jeep Grand Cherokee WK2; 2005-2010 Jeep Grand Cherokee WK; 1999-2004 Jeep Grand Cherokee WJ; 1993-1998 Jeep Grand Cherokee ZJ; 2014-2019 Jeep Cherokee KL; 1984-2001 Jeep Jun 4, 2011 · This is some hard tightening (cheater bars, elbow grease). Jeep Wrangler JK Engine Torque Specs. 4l and wonderng if someone had the torque specs on the idler and tensioner pulleys because Im thinking of changing them since they come in a package with the belt and my jeep is up there in miles. This powerful engine is mated to either a six-speed manual or five-speed automatic transmission, providing plenty of power for off-roading adventures. The recommended tightening sequence involves initially tightening the four corners to 50 in-lbs, then proceeding from the center outwards, increasing to 75 in-lbs, and finally, after allowing it to sit overnight, tightening to the final 97 in-lbs before Jun 29, 2009 · Hey guys, I've done ten searches and can't seem to find the torque specs for the 42RLE transmission pan bolts. 8L V6 (205hp) and 4-speed automatic many dubbed as a ‘slushbox’. Oct 19, 2018 · i know on the JK, front drive shaft to axle flange bolt torque spec was 81 lb/ft or 110 N-m. Kit #1980880. txt) or read online for free. Thanks for the help. * **Front Upper Control Arm:** 75 ft-lbs (at the axle and frame brackets). Oct 13, 2015 · According to the 2008 service manual Tighten water pump bolts to 105 in. lbs. 5 lift, 35x12. Nov 23, 2010 · 338 posts · Joined 2010 there is a zip file with ALL of the torque specs in the write up section here A forum community dedicated to Jeep Wrangler JK owners Save wrangler JK torque specs For Later. I did it in the driveway last time I did it but you need the proper torque Jeep Wrangler JK Suspension Torque Specs . It's important to torque the filter cap properly to avoid cracked housings, especially since these models use a cartridge filter system. bolt pattern. JKS customer service reportedly advises tightening the jam nut "as tight as you can get it," while some users suggest torquing the jam nut to 250-300 ft-lbs. 83 lbs. and tighten with a 1 1/8” socket to factory torque specs. 7L General Grabber AT2's 255/65/17 1" Addco rear sway bar Oct 7, 2010 · Hi, (93 YJ) So I replaced my front brakes, rotors, pads, fluid (front and back brakes) and calipers, but keep having the problem of the fluid leaking from the banjo bolts. I need to change my fluid out and would like to have some resources before I get around to doing the job. 73 opt Mar 26, 2010 · Torque Specs for exhaust manifold/header Jump to Latest Follow 2K views 0 replies 1 participant last post by yoda13 Mar 27, 2010. The new Premium Lower Ball Joints are designed with an adjustable preload ring. 88's on ARB lockers front and rear, ARB diff covers, ARB twin compressor, Apollointech buss controls, VKS prerunner rock sliders, Steinjager tube doors, Bartact molle seat Mar 20, 2018 · The Jeep Wrangler received its first major overhaul since 1998, and kicked off 2007 with all new features like shorter grille slats, clearly separated fenders, and fog lights incorporated into the front bumper. (3) If equipped, position the rear tow eye on the bumper. I do remember seeing a Aug 18, 2008 · I need help finding the torque spec for the axle retainer plate bolts (4) that hold the axle in on the Driver's side shaft. Apr 11, 2021 · That seemed a little light for an 18mm bolt as well as the use. Then you use an inch-pound torque wrench to set the bearing pre load. This recall addressed a potential issue with the driver’s frontal airbag circuit , which could prevent the airbag from deploying in a crash, posing an increased risk of injury. That's not much, so sequence isn't important. This new engine Jeep Wrangler JK Drivetrain Torque Specs. Mar 7, 2018 · SOLD 2018 Gobi Recon unlimited, Mopar 2" lift coils combined with RK rear coils wedges, AEV geo brackets, AEV rear track bar, TF rear track bar bracket, Falcon 3. Good luck with the service! Mar 21, 2010 · Stealership told me 120 LOL ! Tire shop checked some tech site and said 90 was what is called for . Some users torque to 95 ft-lbs, while others suggest a range of 92-132 ft-lbs based on the 2008 FSM, or 100 ft-lbs for ease of reading on a torque wrench. Jeep CJ Showcase. Jun 3, 2020 · Dana Super 30 is 186MM, Dana 30 is 181MM. track bar, N-fab step sliders, Red Rock bed sliders. Mar 5, 2022 · 3. 9 metric bolt, and the maximum for that bolt, fine thread, was 154 ft-lbs. Over 6,000 Automotive Torque Specs. Position pulley on water pump hub. View attachment 3509210 I had to use a rope to hold the harmonic balancer while attempting to torque it down. | Free shipping over $70. Dec 3, 2010 · I'm about to change out my transmission fluid on my 01 WJ it has a 5-45RFE in it and for the life of me I can't find the torque specs for the tranny pan bolts. Dec 11, 2013 · What are the torque specs for the plenum bolts & the intake manifold bolts? 417 posts · Joined 2010 Jeep Enthusiast Forums provides answers from our Here is a list of lug nut torque specs and sizes for a Jeep Wrangler. May 12, 2011 · A forum community dedicated to Jeep Wrangler JK owners and enthusiasts. They're saying to torque the crossmember bolts, skid plates, transmission mount, etc. 2008 JK Sahara Unlimited, 3. 2021-2025. Explore the Jeep Wrangler (JK) 3. I thread it by hand, use an electric 1/2" impact gun with a 100-125 ft-lb torque stick, then finish it off with the 175 ft-lb setting on the Snap-On torque wrench (got off craigslist for about $50 if i remember correctly). 5. com” I bought a downloadable copy of the Chrystler 2015-2017 JK factory service manual for around $17. The front axle is likely a Dana 30. 125" (2) Axle shaft nut torque: 175 ft*lb (3) hub bearing bolt torque: 75 ft*lb 2007 - 2018 Jeep Wrangler JK and JKU Front Dana 44 (216 mm / 8. 2011-2019 Jeep Grand Cherokee WK2; 2005-2010 Jeep Grand Cherokee WK; 1999-2004 Jeep Grand Cherokee WJ; 1993-1998 Jeep Grand Cherokee ZJ; 2014-2019 Jeep Cherokee KL; 1984-2001 Jeep Explore the Jeep Wrangler (JK) 3. Show Less Jeep Wrangler Forum provides answers from our community and over 22 other related forums. O. May 30, 2017 · To fix an oil pan gasket leak on a 2014 Jeep Wrangler 3. 6l pentastar 6 285 hp @ 6,400 rpm 260 lb/ft @ 4,800 rpm Jan 12, 2010 · A forum community dedicated to Jeep Wrangler JK owners and enthusiasts. 00! Bolt Sizes & Torque Specs|Northridge4x4 866-601-5340 Jeep Wrangler JK Showcase. 1945-1986. i've got one. 6L Pentastar engine, the torque specs for the belt tensioner and idler pulleys are as follows: * **Belt Tensioner:** Top bolt: 24 ft lbs, Bottom bolt: 17 ft lbs * **Idler Pulleys:** The idler pulley assembly consists of two parts: (1) the idler pulley, which is fastened to the idler pulley bracket, and (2) the idler pulley bracket, which is fastened to the Mar 20, 2018 · 2010 Jeep Wrangler JK Specs Jeep Wrangler rolls into its fourth year of the JK era sporting a revised and much easier to use soft top, as well as new standard features such as fog lamps, tow hooks, outdoor temperature gauge and eco drive system across the entire Wrangler line – all helping refine the vehicle while it firmly retains its rugged Sep 24, 2009 · 2009 Jeep Wrangler JK, 2-Door, Soft Top, Automatic, Black Procomp Aluminum Wheels with 315x75R16 Goodyear Wrangler Duratracs, 2" Black Diamond Lift, JKS Adjustable Track Bars, Smittybilt Rock Rails Feb 6, 2009 · Can someone post torque spec's from 07-09 JK Factory Service Manual? I am installing the Greenstuff 7000 and 6000 (front and rear) disc brake pads Lug nuts Caliper Mounting Bolts, Front Caliper Mounting Bolts, Rear Anything else I've missed: Nov 27, 2012 · A forum community dedicated to Jeep Wrangler JK owners and enthusiasts. 5” From the Aug 11, 2018 · The instructions posted here by Wfd1244 specify that you should first torque the ball joint, and then continue past that point to the next available slot for the cotter pin. They are indispensable for the DIYer. These are all the torque settings that I have at the moment for Jan 28, 2022 · The torque specs for the caliper mounting bolts on a 2018 Jeep JKU are shown in the attached image (4533580). 5" Rubicon Express lift with (5) 35/70R17s' BFG KM2s' on Pro Comp Xtreme Alloys 7069 Series, Red Rock, Crystal Pearl, Galaxy CB Radio, Hella FF lights, Smittybilt XRC front and rear bumpers, Xenon Flat Fenders, 12K Mile Marker winch, front and rear Rugged Ridge diff guards, Mopar slush mats, and Vision X led rock lights, IPF 920H4 JK Headlights Jan 18, 2019 · Jeep JK undercarriage rattle; Jeep JK A/C Blend Door Actuator Replacement; Jeep JK multi-function switch replacement; Jeep JK 3. Bolt sizes and torque specifications for tons of parts on your Jeep JL or Jeep JK. If someone has subscribed to the service manual maybe they'll post. 21mm tightening- (125 ft pounds torque) !Don't let the caliper hang from the vehicle without support. Come join the discussion about performance, modifications, classifieds, reviews, engine swaps, troubleshooting, suspension, and more! Jan 22, 2025 · Looking for a list of torque specs for your JL Wrangler? A user on the forum shared a link to a Wayalife thread that contains a reference guide. Both were substantial upgrades over the older 3. May 5, 2016 · I am replacing the front hub assembly on my 07 wrangler and have been seeing two different torque requirements for the the axle nut on the web; many procedures suggest 175 ft-lbs but when i look up 07 wrangler torque specs I get 100 ft-lbs. 5" lift, Falcon shocks, 35" Dick Cepek M/T tires My build: Copper Rubi build 2010 BMW Z4 35i - toy 2016 Volvo XC90 - dogmobile Feb 17, 2019 · 2014 JK Unlimited Rubicon, Copperhead Pearl, minivan engine, 6 speed, 4. Reference the model year in the table to see what lug nut torque and size is applicable for your All Jeep Wrangler JK Rubicon versions offered for the year 2010 with complete specs, performance and technical data in the catalogue of cars Horsepower/Torque Mar 4, 2023 · Serpentine belt and tensioner replacement on Jeep Wrangler JK 3. 1 shocks, Toyo AT3 35x11. torque wrench to tighten the lower ball joint’s preload adjustment nut. See Photo 3. Oct 27, 2020 · I have a 2014 2D Sport JK that just rolled over 10K. 1987-1995. After a couple hours on the web, I found “servicemanualwarehouse. Apr 26, 2019 · For installing a Rubicon Express oil pan skid on a Jeep Wrangler JK, the torque specs are as follows: The upper oil pan bolts should be torqued to 8 ft-lbs (or 105 inch-lbs), and the bell housing bolts should be torqued to 20 ft-lbs. Jul 31, 2011 · '09 JKRU. The gasket is now leaking. Sierra Gear & Axle parts are designed and engineered to the highest quality specifications for use in street, off-road and performance environments. Tighten the nuts to 67 N·m (50 ft. A forum community dedicated to Jeep Wrangler JK owners and Mar 20, 2018 · The legendary Jeep Wrangler entered 2012’s marketplace bearing its generation’s first significant upgrade – an all new 3. Jul 27, 2012 · Need torque specs for flywheel, pressure plate Jump to Latest 36K views 5 replies 2 participants last post by YjStrangler92 Jul 30, 2012 Feb 27, 2009 · Page 1 of the 2007 Jeep Torque Specifications for all the nuts and bolts on the Jeep Wrangler JK's . While a specific sequence isn't provided, the user plans to torque the four larger bolts (40 ft-lbs) around the coolant ports first, followed by the nine smaller bolts (20 ft-lbs) around the oil ports and edges, hoping this approach will properly seal the cooling For the 2009 Jeep Wrangler equipped with the V6-3. 6L Torque Specs Jump to Latest 6. Jun 5, 2008 · JK Torque specs Jump to Latest 18K views 14 replies 11 participants last post by NE Wrangling Jun 6, 2008 Apr 6, 2017 · 2015 JKUS Barricade trail force front and rear bumpers, Smittybilt XRC9500 winch, Teraflex 2. 5” leveling kit with 3/4” spacers out back, Mammoth Wheels, JKS front adj. Need all torque specs for the swap, thanks. Tighten the three set screws. Install bolts and tighten to 250 in. Save Share Reply Quote Like Jan 13, 2023 · To find the correct torque specs for your Jeep JK's transmission pan bolts, consult the Jeep Factory Service Manual (FSM) for the most accurate information. used the old washers and it leaked, so I used new copper washers and same issue. Determine which transmission you have by counting the number of forward gear ranges. 5r16 Mickey Thompson baja mtz on mammoth rims, Artec trussed front and rear, upper and lower c-gussets, LCA armor, 4. I orig. " Tighten down until the nut stops , and then hit it one more quick time" They didn't even give me preload torque. The Jeep Factory Service Manual for 2005-2010 lists 88 ft-lb. 88, trussed axles, tons of armor, Rock Krawler X-Factor 2. 5" lift, Falcon shocks, 35" Dick Cepek M/T tires My build: Copper Rubi build 2010 BMW Z4 35i - toy 2016 Volvo XC90 - dogmobile Oct 20, 2019 · Asked this same question in a Facebook group and someone posted the Haynes manual torque sheet. Anybody actually have a REAL JEEP answer ? I think 90 on an alloy wheel sounds reasonable 120 would be to much stress I would think and by looking at that joke of a universal lock nut key ( Yes anyone with a JK lock nut key can steal your spare or all of your factory locked wheels ) 120 lbs The Wrangler JK series has faced several recalls, including a major one in 2016 for models produced between March 2, 2006, and August 13, 2010. It's crucial not to overtighten these bolts, as the bolt holes can strip easily. You tighten a little and see if the pinion moves in and out. Do not exceed factory specifications on this nut. Any help is appreciated, thanks Jul 12, 2016 · I'm about to install JCR's replacement crossmember and I'm a little confused on the torque settings they're specifying. Wrangler JK Steering Specs. 6L engine, the torque specs are as follows: Oil pan drain plug (M14) - 20 lb-ft, and Oil filter cap - 18 lb-ft. Locate the transfer case yoke. Front AXLE - 186FBI DESCRIPTION Axle Ratio Ring Gear Backlash Pinion Torque To Rotate - Original Bearings Pinion Torotate - New Bearings Differential Total Torque to Rotate: pinion torque to rotate plus. Some users torque to 90 ft-lbs if using alloy wheels with 60 degree cone spline lugnuts. Another user was looking for clarification on the track bar axle bolt torque specs, specifically what the '+ 115°' means after the ft-lbs measurement. 5 Grade 10. Whether the 3. 8 and 3. For the 2007-2009 JK Wranglers: Extend the shock all the way. I point out the obvious, search for the truth, and speak fluent sarcasm. I May 24, 2017 · According to Haynes, the Rear-driveshaft-to-transmission and Rear-driveshaft-to-differential flange bolt torque is 80 ft-lb. Jun 15, 2015 · 2014 JK Unlimited Rubicon, Copperhead Pearl, minivan engine, 6 speed, 4. PDF. 8L Engine Torque Specs; 2. Come join the discussion about performance, modifications, classifieds, reviews, engine swaps, troubleshooting, suspension, and more! May 21, 2022 · However, I had no idea how tight to torque them. Took it to dealership, said it was an oil filter housing leak, fixed it under warranty. Jan 17, 2011 · I go with snug and a tweak, it is too easy to frell up a new gasket by over torquing. 6. Jeep Wrangler TJ Showcase. Manual Transmission (NSG370) Torque Specs; 2010 Wrangler Parts; 2009 Wrangler Parts; 2008 Wrangler Parts; May 27, 2022 · The torque specs for caliper bolts are as follows: * **Front caliper adapter bolts:** 120 ft/lb * **Rear caliper adapter bolts:** 55 ft/lb * **Front & Rear caliper mounting bolts:** 26 ft/lb It is recommended to use red Loctite on the bolts, though blue Loctite can also be used. Thanks everyone! 2013 Jeep Wrangler Sahara - White with Black Hard Top - Auto Trans, LSD with 373's, Remote Start, Mopar Hood Lock with Grill Guard, GraBars, VDP Stubby Front Bumper and Daystar Leveling Kit. But I have a feeling that they are being torqued to the specified torque value, and then if the hole is already lined up, they are being left in this position. Dec 19, 2014 · 2010 Flame Red JK Sport 6 spd/RK 1. 2011-2019 Jeep Grand Cherokee WK2; 2005-2010 Jeep Grand Cherokee WK; 1999-2004 Jeep Grand Cherokee WJ; 1993-1998 Jeep Grand Cherokee ZJ; 2014-2019 Jeep Cherokee KL; 1984-2001 Jeep Jan 10, 2009 · Kevin M. 5-17 on AEV Salta wheels, Falken AT3W 255/80-17 on stock recon wheels, Grabars, RE gas skid tank, mopar head liner, Warn VR10 and Maximus3 winch plate. 2010 Jeep Wrangler JK 4x4 specifications, Horsepower/Torque Curve. This time I used my front wheel under the Jeep to hold the caliper, but I have used wire coat hangers at times. Get all the Info. Torque specs back there: 100 ft/lb for the bolts that hold the ball joint to the diff, 105 ft/lb for the nut on the ball joint. 8 with part numbers, serpentine belt routing diagram, and torque specs. Upside: Has every imaginable repair. 204 Too much to list - see my profile for details on build 16 JK Rubi with all the trimmings NRA Life member "It takes a special kind of stupid to believe criminals will follow gun laws. Mar 31, 2020 · Produced from 1997-2006, many consider the Jeep Wrangler TJ to be the last true Wrangler. Apply loc-tite on the stock nut and tighten with a 1 1/4” socket to factory torque specs. Turns out, the factory manual calls for more than twice that torque. I actually busted an alloy D44 axle shaft with '33s on my TJ and Alloy finally got a replacement shaft out to me. May 9, 2017 · If you've potentially over-tightened the upper oil pan bolts on your 3. 2011-2019 Jeep Grand Cherokee WK2; 2005-2010 Jeep Grand Cherokee WK; 1999-2004 Jeep Grand Cherokee WJ; 1993-1998 Jeep Grand Cherokee ZJ; 2014-2019 Jeep Cherokee KL; 1984-2001 Jeep 2009 Jeep Wrangler JK 4x4 specifications, all versions. This transfer case uses around 2 quarts of ATF 4 Aug 28, 2014 · ColdCase, Do you happen to have access to the torque values for bolts 2 and 5 shown in the attached diagram of the front suspension cradle? I am having the cross member brackets replaced and I'd like to be able to double check these bolts, given that they appear to hold on the rear portion of the front suspension cradle to the frame! Oct 27, 2010 · Need all torque specs for the swap, thanks. 5 RK lift, 35s lunchbox locked 30 front 44 LSD rear Ocala Jeep Club CERT member. Just use a 1/4" drive socket and go easy. Jeep Wrangler JK Drivetrain Torque Specs. So I torqued them to less I went 110 ft-lbs. Life Is Good Jeep Apparel; Paints & Coatings; Wrangler JK Spark Plug Specifications May 12, 2019 · The user is installing a crate motor in their 2007 Jeep Wrangler JKU and needs the torque sequence for the timing chain cover bolts. Dana 30 was usually on old vehicles like Cherokee XJ's, Grand Cherokee ZJ's Comanches, CJ's (5,7,8) Wagoneer SJ's, YJ's, and TJ's, along with dana 44's. It's also recommended to use a new pinion nut. 4. Aug 12, 2012 · I believe the factory specs for acceptable ball joint play, is about 1. 2010 Wrangler Parts; Apr 7, 2012 · The torque specifications for valve cover bolts are as follows: 55 in-lbs when using RTV, and 44 in-lbs when using a pre-cured gasket. 2008 Jeep Wrangler Sahara (3. Surely better methods exist. and also 20. 2011-2019 Jeep Grand Cherokee WK2; 2005-2010 Jeep Grand Cherokee WK; 1999-2004 Jeep Grand Cherokee WJ; 1993-1998 Jeep Grand Cherokee ZJ; 2014-2019 Jeep Cherokee KL; 1984-2001 Jeep Apr 4, 2010 · A forum community dedicated to Jeep Wrangler JK owners and enthusiasts. A/C System Torque Specs; 3. Mar 26, 2010 · 2021 Jeep Gladiator Sport S JT-34s, ASFIR skids, spray in bed liner, Apex sway bar disconnects, Rockhard 4x4 Front 3/4 length bumper, Teraflex 1. 6 torque spec is exactly the same I'm not 100% sure. Feb 6, 2013 · 08 JK 23S - Colorado Jeep Club No. I have done a search of the tech forum and the general forum and I have not be able to locate the thread on JK torque specs. See Photo 4. Jeep Wrangler JK (07-10) Torque Sheet - Free download as PDF File (. Explore the Jeep Wrangler (JK) Unlimited Sahara 2. 6 but I can't imagine the 3. 9K views 2 replies 3 participants last post by dbird29 Mar 7, 2022 Feb 10, 2022 · 2015 Wrangler Unlimited (Tank) Metal Cloak True Dual Rate Springs (2 1/2” lift), Superlift frt & rr adj track bars & Rancho CA bracket, Fox 2. all to 35ft/lbs. Again, tighten a little and recheck how much torque it takes to move the pinion. Oct 8, 2015 · I've seen the torque listed as 15 lbs. Torque to 30 in-lbs (4 N-m). 1987-1995 YJ. It was the the center bolt towards the rear on the bottom as #1, then the center bolt towards to the front on the bottom as #2. Many users report success using 100 ft-lbs. The engine oil pan keeps the oil in place as the oil pump circulates the oil throughout the engine. Mar 30, 2012 · (3)Remove the caliper with two large bolts. Oct 30, 2015 · The recommended torque specification for Jeep Wrangler lug nuts is generally between 95-100 ft-lbs. 4 liter, front wheel drive. Torque to 70 in-lbs (8 N-m). The torque settings list on Project JK though shows 90 for the Aug 27, 2015 · Jeep Wrangler JK Showcase. I cleaned the surfaces well, hand tightened bolts, snugged in a criss-cross pattern, & torqued to 165 in-lbs. Calling itself the Wrangler JK, this Jun 11, 2020 · The recommended lug nut torque for JK wheels is generally between 100-125 ft-lbs. 8 auto 2007, 2008, 2009, 2010, 2011 detailed specs, including 0-60 mph times, horsepower, and handling data. Jeep Wrangler YJ Showcase. Jul 10, 2010 · bolt torque fastener torque jk wrangler specifications torque wrangler Jump to Latest 17K views 5 replies 4 participants last post by Fargo Jul 12, 2010 Mar 20, 2018 · 2010 Wrangler Simplifies Soft Top Abilities & More. There is a site for Jeep JK Torque Specs, depending on what you have. Is there a specific torque to Mar 18, 2017 · The JKS adjustable track bar instructions lack torque specifications for the jam nut and passenger side flange nut/bolt. 8. com - Jeep JK Wrangler Resource » Jeep JK Wrangler Torque Settings Nov 1, 2012 · Remember folks, there's torque specs (and patterns)for a reason 08 2 door (yes they made them) 3. Super 30 entered on JK's and WJ's along with Super 44. The oil pan surrounds the oil pump pickup tube and covers the crankshaft, making its placement and structural integrity important. 4" Teraflex long arm, Teraflex R44 housing, Teraflex / Fox Resis, Poly Performance skids, Nemesis Billy Rockers, Nemesis flares, 37" Nitto Trail Grapplers, 17" 5x5. / 8. Jun 12, 2019 · Exterior Torque Specs Transmission Torque Specs Drivetrain Torque Specs Engine Torque Specs Steering Torque Specs; Body: AX5 Manual Transmission: Brakes: Battery: Steering: Frame and Bumpers: AX15 Manual Transmission: Antilock Brakes: Cooling System: Steering Linkage: Tires and Wheels: NV1500 Manual Transmission: Clutch: Emissions Control Jeep Wrangler JK Suspension Torque Specs . Anybody know the correct torque? This a link to where they suggest 100 Jan 30, 2016 · For a 2003 Jeep Wrangler X model with a 6-cylinder engine and manual transmission, the front pinion nut torque spec is generally between 165-180 ft-lbs. 6L, first ensure the bolts are tightened to the factory specification of 97 in-lbs. 500" Oil capacity with OEM cover: 1 Products include ring and pinion sets, installation kits and axle shafts for GM, Ford, Chrysler, Jeep, and Toyota vehicles. While some experienced mechanics tighten by feel, using a torque wrench is generally recommended to ensure proper tightness and avoid over-tightening, which could damage the plug or differential. Dec 7, 2021 · Getting ready to change serpentine belt on 2015 jeep patriot sport 2. Measure 1. A forum community dedicated to Jeep Wrangler JK owners and Jan 3, 2017 · Project-JK doesn't list the 3. Mar 6, 2025 · Discover essential lug nut sizes and torque specs for all Jeep Wrangler models to ensure safety and optimal performance. ) torque. Shop Suspension. all other drive shaft bolts are 15 lb/ft or 20 N-m. -ft. Get all Mar 20, 2018 · Jeep Wrangler JK Showcase. 2011-2019 Jeep Grand Cherokee WK2; 2005-2010 Jeep Grand Cherokee WK; 1999-2004 Jeep Grand Cherokee WJ; 1993-1998 Jeep Grand Cherokee ZJ; 2014-2019 Jeep Cherokee KL; 1984-2001 Jeep For the 2007 -2009 JK Wrangler follow steps 4-11 clearance For the 2010 to Current JK Wrangler follow steps 12-14 To mount the steering stabilizer above the tie rod for all JK Wranglers use . 6L Pentastar Engine Oil Change; Jeep JK Steering and Suspension Torque Specs; Choosing the right Jul 23, 2014 · For a JK Wrangler lift kit installation, here are the torque specs for the front and rear components: * **Front Lower Control Arm:** 117 ft-lbs (axle bracket nut and frame bracket nut). " I do not consider myself a smartass. Please note that these specifications may vary depending on the year and model of your Jeep, so always consult your owner’s manual or a trusted mechanic for the most accurate information. 8L engine (spec is 105 inch-pounds, or just under 9 foot-pounds) and the gasket isn't damaged or leaking, it's generally advised to leave it alone. Wrangler JK (2007-2018) 1/2 inch (12mm Sep 5, 2007 · looking for lower ball joint nut torque specs for a 2014 Jeep Cherokee, 2. Lug Nut Torque (Nm) Jeep Wrangler JK (2007-2018) 95-115: 129-156: Jeep Wrangler JL (2018-present) Next Post 2011 Hyundai Sonata Lug Nut Torque Specs & Safety Jul 17, 2020 · For a 2018 Jeep Wrangler JK with a 3. Project-JK. Ford Bronco Showcase. 8L engine, I recommend installing the oil pan and tightening the fasteners to 12 Nm (105 in. 8L, 3. If excessive wear becomes apparent and falls out of factory specs (refer to your factory ser- Oct 18, 2010 · I just installed my intake/exhaust on my '87 Renix tonight and IIRC when I looked the book I noticed the H. 8 2007, 2008, 2009, 2010, 2011 detailed specs, including 0-60 mph times, horsepower, and handling data. for the 3. Dwayne Jun 12, 2012 · For a 2012 model, the oil drain plug torque value is 20 ft lbs, and the oil filter housing torque value is 25Nm, which equals 18 ft lbs. Feb 17, 2019 · 2014 JK Unlimited Rubicon, Copperhead Pearl, minivan engine, 6 speed, 4. 6-liter Pentastar V6 engine that pushed out 285hp and 260 lb-ft of torque, as well as an available 5-speed automatic transmission. 00. The Jeep JK is equipped with a 3. 7 ft. 5 millimeters. I would torque it to 15 and go from there. Sep 27, 2024 · The torque value for the Dana 44 front axle carrier bearing cap bolts on a JK is 80 lb/ft. Aug 12, 2019 · 06 GCO, Dk Khaki, QDII, Flshing Hi 3rd Bk Lt, MDS "ON" Lt, Airtab Vortex Gens, Debadged, Fumoto Drain Valve, BT Catch Can, Chopped EGR Tube, SRT8 CAI, AFE Air Filter, 6spd 545RFE, Sonnax Trans Line Press Booster, SC Tuner W/Adv Trans Tune App, DS and HP tuners, Transgo Shift Kit, ARH Long Tube Hdrs w/3 in Magnaflow/Xlerator AP Exh Sys, Bilsteins, SRT Springs/Sways, Cust Eng Cvr, SRT8 frt/rear Sep 24, 2014 · For a 2012 or newer Jeep Wrangler JKU with a 3. Come join the discussion about performance, modifications, classifieds, reviews, engine swaps, troubleshooting, suspension, and more! Jan 12, 2014 · The correct torque value for the front brake caliper bolts on a 2000 TJ Jeep Wrangler is 11-13 ft-lbs. 8 oil pan bolt torque is wildly different so I will go with that. 2001-2010 Duramax Torque Specifications. 2011-2019 Jeep Grand Cherokee WK2; 2005-2010 Jeep Grand Cherokee WK; 1999-2004 Jeep Grand Cherokee WJ; 1993-1998 Jeep Grand Cherokee ZJ; 2014-2019 Jeep Cherokee KL; 1984-2001 Jeep 2007-2018 JK. 2007-2010- 120ftlbs front and 77 rear 2011 and later JKs 100ftlbs Front 77 rear. Nov 19, 2015 · This article applies to the Jeep Wrangler JK (2007-Present). Thanks again, Cortland Cheney May 12, 2018 · I just did the axle on my other car, it took about 240ft lbs to get 18 in lb preload, though that was on a Ford 8. Sep 18, 2014 · lbs. of torque. Dec 11, 2011 · yes, there is a torque wrench that goes that high. However, others recommend 55 ft-lbs. Jeep Wrangler rolls into its fourth year of the JK era sporting a revised and much easier to use soft top, as well as new standard features such as fog lamps, tow hooks, outdoor temperature gauge and eco drive system across the entire Wrangler line – all helping refine the vehicle while it firmly retains its rugged image and off-road ability. 2010. Some users torque to 55 ft-lbs and then tighten further until the castle nut aligns for the cotter pin. The brand also added a curved windshield and better roof integration to the new vehicle, which it said helped reduce interior noise by 20 percent. 2011-2019 Jeep Grand Cherokee WK2; 2005-2010 Jeep Grand Cherokee WK; 1999-2004 Jeep Grand Cherokee WJ; 1993-1998 Jeep Grand Cherokee ZJ; 2014-2019 Jeep Cherokee KL; 1984-2001 Jeep 2010 Jeep Wrangler JK Specs Jeep Wrangler rolls into its fourth year of the JK era sporting a revised and much easier to use soft top, as well as new standard features such as fog lamps, tow hooks, outdoor temperature gauge and eco drive system across the entire Wrangler line – all helping refine the vehicle while it firmly retains its rugged Jeep Wrangler JK Showcase. Apr 19, 2011 · For Jeep Wrangler lug nut torque, the general consensus from other Wrangler owners is around 95-100 ft-lbs for the wheels. 0 Reservoir Adjustable Shocks, Barnes 4WD 7075 Aluminum 1 Ton Steering Kit, Apr 3, 2012 · Should be in herecheck online to make sure the #'s are current. Come join the discussion about performance, modifications, classifieds, reviews, engine swaps, troubleshooting, suspension, and more! Mar 20, 2018 · Jeep Wrangler JK Showcase. 5" Trailready HDs, Spyntec manual hubs, Teraflex front BBK, Teraflex rear BRK, Mopar BBK master/booster, Superior front & Alloy USA rear axle shafts, CTMs, Reids, Synergy drag link & tie rod, WTOR hydro-boosted steering Jan 21, 2015 · I am trying to locate the torque specifications such things as oil filter, oil filter drain plug and general items for the back yard mechanic. Search Car Torque Specifications by Engine or Model New in Jeep JK Wrangler Exterior Parts. uxpcxmzgvaglnfcooupdtgldccimvykfvynvwwvskmkskcfebytwoga